top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|112243352|112251134|-|9|circRNA|HECTD4|ENST00000550722.5|32,31,30,29,28,27,26,25,24

HECTD4

Open Reading Frame (ORF)

LAAQTRWRRGNTRKQALVHMRELLTAAVRVGGVTHLVGPVTMVLQGGPRSLRRMSQEACPFW

Peptide

MSQEACPFW

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page