top of page

CircRNA

Gene

chr12|112210014|112228811|-|9|circRNA|HECTD4|ENST00000550722.5|50,49,48,47,46,45,44,43,42

HECTD4

CircRNA UID

circHECTD4(50,49,48,47,46,45,44,43,42)

Open Reading Frame (ORF)

LCTDLAEEISANFEALPFAMASDSDNDAGTSIASDPGTHGPPCRIAAVATAQQRFR

Peptide

IAAVATAQQR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page