top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|112178930|112185493|-|4|circRNA|HECTD4|ENST00000550722.5|64,63,62,61

HECTD4

Open Reading Frame (ORF)

LRKYGVPKPKFDKSKYSKAGKEQHPVKVVSTKRPITKPPAKDKAVLNSVRKLLVDHGHGSLREGACFPSPGRAPAHGAHPGAEAAPRWPVLLNRPPAEPLPGHADGLAVGAPQAVRRGDAELGLRRRLRGLRGGGGR

Peptide

APAHGAHPGAEAAPR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page