top of page

CircRNA

Gene

chr12|112172670|112179397|-|5|circRNA|HECTD4|ENST00000550722.5|67,66,65,64,63

HECTD4

CircRNA UID

circHECTD4(67,66,65,64,63)

Open Reading Frame (ORF)

MHRCPTCTEGLKKVDPGDGRGTCAVHQPAMPPPRHHTRTAPSP

Peptide

GTCAVHQPAMPPPR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page