top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|110381751|110388623|—|5|circRNA|ANAPC7|ENST00000455511.7|8,7,6,5,4

ANAPC7

Open Reading Frame (ORF)

LNSNSVQALLLKGAALRNMGRVQEAIIHFREAIRLAPCRLDCYEDKHDAGKPVQEGWSGAPFSHQL

Peptide

HDAGKPVQEGWSGAPFSHQL

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

20

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page