top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|109456117|109458078|—|3|circRNA|KCTD10|NM_031954|6,5,4

KCTD10

Open Reading Frame (ORF)

MLLGMKSAAGPFMVRAGRLLKSVVPPSSMPLRRNRPRTKILMSLSARSL

Peptide

LLKSVVPPSSMPLR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page