top of page

CircRNA

Gene

chr12|109201566|109212936|+|4|circRNA|ACACB|ENST00000338432.11|19,20,21,22

ACACB

Open Reading Frame (ORF)

MQPPCSGRLIERSSSSTPRASCSWSRGDEDDHDPERSGKRPGEVHQASRCRAGSRLRGGQAGAR

Peptide

MQPPCSGRLIER

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page