top of page

CircRNA

Gene

chr12|109166860|109174230|+|5|circRNA|ACACB|ENST00000338432.11|3,4,5,6,7

ACACB

CircRNA UID

circACACB(3,4,5,6,7)

Open Reading Frame (ORF)

MWALGDKIASTVVAQTLQVPTLPWSGSGRACRDSTW

Peptide

IASTVVAQTLQVPTLPWSGSGR

ORF Found in Long-Read

false

Peptide Length

22

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

21

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page