top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|108658737|108662158|—|2|circRNA|CORO1C|ENST00000261401.7|5,4

CORO1C

Open Reading Frame (ORF)

LECGNRGSPYKLGRYAFRHDLQCELEPEWQSDLHSFQRQESESH

Peptide

LGRYAFR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page