top of page

CircRNA

Gene

chr12|108652271|108654410|-|2|circRNA|CORO1C|ENST00000261401.7|8,7

CORO1C

CircRNA UID

circCORO1C(8,7)

Open Reading Frame (ORF)

LRSRMNPRTSTTSTHSAARSLREGWVTCPRGDLMLTNVRLPEKYAGTNCSS

Peptide

EGWVTCPR

ORF Found in Long-Read

true

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

riboCIRC,TransCirc

riboCIRC,TranCirc

Potential Cryptic Translation

false

bottom of page