top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|108526098|108526553|-|1|circRNA|SART3|NM_014706|16

SART3

Open Reading Frame (ORF)

LFPPVWIRAKTPILRAAFQTQKGREQHPCSWRNTKCRSSSRARWEMCCRRCGAPFEAEGEGSLPEEGHAQGAARQQQGQHHRLCQQPALQHAGAGHEAQATLRGLWGGGPDPTHLQQPWGFPRLLLRGV

Peptide

CGAPFEAEGEGSLPEEGHAQGAAR

ORF Found in Long-Read

false

Peptide Length

24

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

24

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page