top of page

CircRNA

Gene

chr12|108526098|108526553|—|1|circRNA|SART3|NM_014706|16

SART3

Open Reading Frame (ORF)

LSATCPTACRSRTRSSGHSSRPVGRWSRSDPSSATVGISEVTATWSLKKRNQPFRHWRWTGKV

Peptide

SSGHSSRPVGRWSR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page