top of page

CircRNA

Gene

chr12|106070773|106083929|-|3|circRNA|NUAK1|ENST00000261402.6|6,5,4

NUAK1

Open Reading Frame (ORF)

LGVLLYTLVYGTMPFDGFDHKNLIRQISSGEYREPTQPSERCGPPGLEAGKYTAR

Peptide

CGPPGLEAGKYTAR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page