top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|106070773|106083929|—|3|circRNA|NUAK1|ENST00000261402.6|6,5,4

NUAK1

Open Reading Frame (ORF)

LGPGCVALHSCLWNNALRWFRSQKPHSANQQRRVPGANTALRTVWSTGT

Peptide

LGPGCVALHSCLWNNALRWFR

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

21

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page