top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|101786011|101790057|—|3|circRNA|GNPTAB|NM_024312|5,4,3

GNPTAB

Open Reading Frame (ORF)

LLTHCIKVPMLVLDPALPANITLKDLPSLYPSFHSASDIFNVAKPKNPSTNVSVVVFDSTKDGFVCPCRLTLFTPG

Peptide

DGFVCPCR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page