top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|101291741|101295658|+|4|circRNA|UTP20|ENST00000261637.4|9,10,11,12

UTP20

Open Reading Frame (ORF)

LSYIVNCFLIDDAVVKDEALAILAKLILNKAAPPTAGSMAIEKYPLVFSPQMVGNRSWIYTQK

Peptide

AAPPTAGSMAIEKYPLVFSPQMVGNR

ORF Found in Long-Read

false

Peptide Length

26

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

24

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page