top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|94850113|94859715|+|3|circRNA|AMOTL1|ENST00000317829.12|6,7,8

AMOTL1

Open Reading Frame (ORF)

MPEYNAPALLELVREKEERILALEADMTKWEQKYLEESTIRHFAMNAAATAAAERQRILEGKGEIRNGVSSSADCK

Peptide

NGVSSSADCK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page