top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|93691682|93706897|+|8|circRNA|CEP295|ENST00000325212.10|11,12,13,14,15,16,17,18

CEP295

Open Reading Frame (ORF)

LGAHWPMIRLVVFNWLAKRMSVVMTMMKQLLKVIH

Peptide

MSVVMTMMKQLLK

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page