top of page

CircRNA

Gene

chr11|8965903|8968041|+|3|circRNA|TMEM9B—AS1|ENST00000525484.5|2,3,4

TMEM9B-AS1

Open Reading Frame (ORF)

MGTEYVSRAAGATADVTGFPEIKHHSAGTRVAGLDVLSPDCPVKVLSL

Peptide

HHSAGTR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page