top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|86392540|86400801|+|4|circRNA|CCDC81|NM_001156474|4,5,6,7

CCDC81

Open Reading Frame (ORF)

MCEGDVAFFIAFHFHETKCGVYIQRNWGPHDQRQQSEDEVL

Peptide

CGVYIQR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page