top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|86306244|86306482|+|1|circRNA|C11orf73|ENST00000533986.5|2

C11orf73

Open Reading Frame (ORF)

MLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKSGANSCTASGRG

Peptide

ISGLKSGANSCTASGR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

8

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page