top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|83163678|83169995|+|6|circRNA|PCF11|ENST00000298281.8|3,4,5,6,7,8

PCF11

Open Reading Frame (ORF)

LRGVMVHQGLRLGLMDLMVSQEVESDLRALCYSKGLE

Peptide

GVMVHQGLR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page