top of page

CircRNA

Gene

chr11|78559620|78566131|—|1|ciRNA|NARS2|ENST00000281038.9|4

NARS2

Open Reading Frame (ORF)

LQRLCNSGYRLPLGCIQIHTAPVSPRRFLPLEKAPSDSLLVKELKNIMALRHMLLIRQRKINQII

Peptide

HMLLIRQR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page