top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|78225107|78227051|—|2|circRNA|GAB2|NM_012296|5,4

GAB2

Open Reading Frame (ORF)

LYKNLPRAMDTVSTGSVVKSMASIAFPSRAGTIQNSETVPTTSPAAWPPMATPRAASQAPRQIMRMCTPSRRPATPCAGSSGTSW

Peptide

RPATPCAGSSGTSW

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page