top of page

CircRNA

Gene

chr11|78109441|78124214|-|7|circRNA|ALG8|NM_001007027|9,8,7,6,5,4,3

ALG8

CircRNA UID

circALG8(9,8,7,6,5,4,3)

Open Reading Frame (ORF)

LPYWQLQSGRWITPLSLHGLSISCHMLPNILIKKC

Peptide

LPYWQLQSGR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page