top of page

CircRNA

Gene

chr11|77907716|77922471|-|6|circRNA|INTS4|ENST00000433818.6|17,16,15,14,13,12

INTS4

Open Reading Frame (ORF)

LQRLGELQSELAGVADFSATYLRCQLLLIKVLEVSGKSASNPGASLGARASEHPPIF

Peptide

VLEVSGK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page