top of page

CircRNA

Gene

chr11|75851882|75912039|+|5|circRNA|UVRAG|ENST00000356136.7|2,3,4,5,6

UVRAG

Open Reading Frame (ORF)

MLRRLFFCRWIRTVFAILTMSSLCYAASSTSSEHCCPEHC

Peptide

LFFCRWIR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page