top of page

CircRNA

Gene

chr11|73981641|73982720|-|1|ciRNA|UCP2|ENST00000310473.7|1

UCP2

CircRNA UID

ciUCP2(1)

Open Reading Frame (ORF)

LSLHLFTPSFPPRCRALPWMGTISDDHNDLSLTRQLQAVFLHRLSQGLGAFSSGL

Peptide

QLQAVFLHR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page