top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|71092421|71119032|-|5|circRNA|SHANK2|NM_012309|7,6,5,4,3

SHANK2

Open Reading Frame (ORF)

LVHPQIIKTVTASPRCITQPSSEVIPTAASFSCTNTPLCAAKMRTAGTRSTRNAFDLTRMPQCGLQSSGSCVH

Peptide

TVTASPR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page