top of page

CircRNA

Gene

chr11|7038565|7070456|+|10|circRNA|NLRP14|ENST00000299481.4|2,3,4,5,6,7,8,9,10,11

NLRP14

CircRNA UID

circNLRP14(2,3,4,5,6,7,8,9,10,11)

Open Reading Frame (ORF)

LEYCGLTSLCCQDLSSALICNKRLIKMNLTQNTLGYEGIVKLYKVLKSPKCKLQVLGGLNIWTRWQIHHHLLSFLILGCYCIWRS

Peptide

CKLQVLGGLNIWTR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page