top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|68761534|68762761|—|2|circRNA|CPT1A|ENST00000540367.5|15,14

CPT1A

Open Reading Frame (ORF)

LGSIVTSSAFTWCLNISLWSPLSLRKTWASFASHTRPP

Peptide

LGSIVTSSAFTWCLNISLWSPLSLR

ORF Found in Long-Read

true

Peptide Length

25

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

25

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page