top of page

CircRNA

Gene

chr11|66193485|66211259|+|3|circRNA|PACS1|NM_018026|2,3,4

PACS1

CircRNA UID

circPACS1(2,3,4)

Open Reading Frame (ORF)

LQIMLQRRKRYKNRTILGYKTLAVGLINMAEAIQLDPEETRHAKRNGQRS

Peptide

AIQLDPEETR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page