top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|65714494|65714910|+|2|circRNA|KAT5|ENST00000377046.7|8,9

KAT5

Open Reading Frame (ORF)

MRFTARAPSPSLRLMDVRTRTPRTALMEYRQHHA

Peptide

APSPSLR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page