top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|6556682|6559283|+|4|circRNA|DNHD1|ENST00000254579.10|25,26,27,28

DNHD1

Open Reading Frame (ORF)

LENLRMLIKEHGTHANLIFDLEQQLKDSGKTQRRAASQCWRLCARPWMALCMPTAPWNCRRCSLQSTSLPLSQCQDTVSAHCVHASFDSSQSWPWKA

Peptide

AASQCWR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page