top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|6456071|6458296|—|5|circRNA|TRIM3|NM_001248007|6,5,4,3,2

TRIM3

Open Reading Frame (ORF)

MSPKLYPCPEPDAILSSMPADVHPPRAGRLGTAEQLLHQQPHGGNAAGT

Peptide

LGTAEQLLHQQPHGGNAAGT

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

20

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page