top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|62629813|62630836|—|4|circRNA|GANAB|ENST00000532402.5|13,12,11,10

GANAB

Open Reading Frame (ORF)

MNEPSVFNGPEVTMLKDAQHYGGWEHRDVHNIYGLYVEPRRCPHSSPSATTRAVGTTGTRLMCWKWIRALMITTCPVMSSG

Peptide

ALMITTCPVMSSG

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page