top of page

CircRNA

Gene

chr11|62516873|62517009|-|1|ciRNA|AHNAK|ENST00000525875.1|1

AHNAK

CircRNA UID

ciAHNAK(1).A

Open Reading Frame (ORF)

LEGGKVKGKHGKLKFGTFGGLGSKSKGHYEVTGSDDETGKLWGSVSGRWES

Peptide

LWGSVSGR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page