top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|62128150|62130590|+|3|circRNA|INCENP|ENST00000394818.7|2,3,4

INCENP

Open Reading Frame (ORF)

LWWRSASVSARMLSSMSPSSCPPSLCPALCPRLQLQPQLQPPRASRHQMRNQHLRSRRPGYWSPSQ

Peptide

HQMRNQHLR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page