top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|61966459|61966988|-|1|ciRNA|FTH1|ENST00000532601.1|1

FTH1

Open Reading Frame (ORF)

LGAGGRWLILWVDPSRAAVSTSRLCLSLSPTCFEAYL

Peptide

LGAGGRWLILWVDPSR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page