top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|59658865|59659469|—|2|circRNA|PATL1|ENST00000300146.9|4,3

PATL1

Open Reading Frame (ORF)

LNSSIWDGSEVLRRIRGPLLAQMMIGRKHMSAWLNWKKSYQWQLMNKQAMEREMKWTCWVTMRRIWQKGSVRW

Peptide

GPLLAQMMIGR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page