top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|57791673|57794006|+|1|ciRNA|CTNND1|NR_037646|4

CTNND1

Open Reading Frame (ORF)

LGSYSPFGDGLSSARSSRDFFPGVLNADKRQGILLLD

Peptide

LGSYSPFGDGLSSAR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page