top of page

CircRNA

Gene

chr11|47788181|47801930|-|9|circRNA|NUP160|ENST00000378460.6|31,30,29,28,27,26,25,24,23

NUP160

CircRNA UID

circNUP160(31,30,29,28,27,26,25,24,23)

Open Reading Frame (ORF)

MVTLLVQAGLFDTAISLCQTFKLPLTPVFEGLAFKLWNVFVRQHLK

Peptide

LWNVFVRQHLK

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page