top of page

CircRNA

Gene

chr11|47743952|47754664|-|6|circRNA|FNBP4|ENST00000263773.9|8,7,6,5,4,3

FNBP4

Open Reading Frame (ORF)

MVVCQGLVHVLISASQHLKMECVGLCLKEENGRCLFELPVQNLPVGVLVKLDEILQKMEKLAVYACLVLMLTVMTMTMMFPKN

Peptide

AVYACLVLMLTVMTMTMMFPK

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

21

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page