top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|47734024|47751290|—|6|circRNA|FNBP4|ENST00000263773.9|10,9,8,7,6,5

FNBP4

Open Reading Frame (ORF)

LANTLTSKFEFLGINRQSISNFHVLLLQTESELRWAIGRKSGMRTRDVIIIGIHKQMK

Peptide

QSISNFHVLLLQTESELRWAIGR

ORF Found in Long-Read

false

Peptide Length

23

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

9

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page