top of page

CircRNA

Gene

chr11|46688172|46696156|-|3|circRNA|ARHGAP1|NM_004308|4,3,2

ARHGAP1

Open Reading Frame (ORF)

LSNAPQPPARPQQAPGVSLKVLQGKAVWDRLGHGSALRAAG

Peptide

LGHGSALR

ORF Found in Long-Read

true

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page