top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|46433473|46508370|—|6|circRNA|AMBRA1|NM_017749|15,14,13,12,11,10

AMBRA1

Open Reading Frame (ORF)

LSPMGRYVMVGLASRRILLHPSTEHMVAQVFRLQQAHGGETSMRIISCCILRPEDDPVSLTERQYSPALHALPTEPSPFFHLLLFLRQPGSISRGNRLGI

Peptide

IISCCILRPEDDPVSLTER

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page