top of page

CircRNA

Gene

chr11|4082183|4086543|+|4|circRNA|STIM1|ENST00000300737.8|8,9,10,11

STIM1

CircRNA UID

circSTIM1(8,9,10,11)

Open Reading Frame (ORF)

MAWDLRGSGGLEESREGARISQLMVCSRGPSEVAAADT

Peptide

MAWDLRGSGGLEESR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

8

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page