top of page

CircRNA

Gene

chr11|35312197|35317516|—|3|circRNA|SLC1A2|NM_004171|4,3,2

SLC1A2

Open Reading Frame (ORF)

LLSTVPTICPSRWKCECTTVILAQRNPSTGTWACACVTSWGRICCSP

Peptide

CECTTVILAQR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page