top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|35201081|35211449|+|7|circRNA|CD44|NM_000610|8,9,10,11,12,13,14

CD44

Open Reading Frame (ORF)

MMSQVEEETQIILKAQLLYWKVIPLITHTRRKAGPSSQ

Peptide

AQLLYWK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page