top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|34115822|34122592|+|4|circRNA|NAT10|NM_001144030|4,5,6,7

NAT10

Open Reading Frame (ORF)

LLHSQLLEDGENLQPWDWRLLGRWHLGCAFQVQN

Peptide

LLGRWHLGCAFQVQN

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page